PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa017734
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family G2-like
Protein Properties Length: 261aa    MW: 28850 Da    PI: 7.0875
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-11899PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.85.8e-343993155
    G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
               kprlrWt eLHerFv+av+qLGG++kAtPk i+++m+vkgLtl+h+kSHLQkYR+
  Lsa017734 39 KPRLRWTAELHERFVDAVTQLGGPDKATPKMIMRTMGVKGLTLYHLKSHLQKYRM 93
               79****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.3E-333694IPR009057Homeodomain-like
PROSITE profilePS5129412.8113696IPR017930Myb domain
SuperFamilySSF466895.2E-173895IPR009057Homeodomain-like
TIGRFAMsTIGR015574.9E-243994IPR006447Myb domain, plants
PfamPF002496.0E-84192IPR001005SANT/Myb domain
PfamPF143792.4E-25137183IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MYSGIHSIPL EGTGIDFPRP LTSTNLVGDP CLVLTTDPKP RLRWTAELHE RFVDAVTQLG  60
GPDKATPKMI MRTMGVKGLT LYHLKSHLQK YRMGKQSCKE FPENSKEASC IAESQDMGSS  120
TSSSTRMMAQ DLNDGFEVTE ALRAQMEVQR RLHDQLEVQH RLQLRIESQG KYLQSILEKA  180
CKAINDQAIA TAGLEAAREE LSELAIKVAN DCPPSVTQID SCLTSNPSPE SPMGLSPQAA  240
ALKKRQRAMF MQAEWMASNT G
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002300173.21e-134myb family transcription factor family protein
SwissprotQ9SAK51e-67APL_ARATH; Myb family transcription factor APL
TrEMBLA0A103Y0T41e-162A0A103Y0T4_CYNCS; Homeodomain-like protein
STRINGVIT_05s0029g00060.t011e-120(Vitis vinifera)